PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI03G31480.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 737aa    MW: 82827.6 Da    PI: 6.677
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI03G31480.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS365.76.3e-1123567141361
             GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                      l++lL++cA+av+++d + a++lL++++++a p+gd  qRla +f+ +L+arla+++s+ly++l +++t+    s+ l+a++l+  ++P+ ++s
  ORUFI03G31480.1 356 LRTLLIHCAQAVAADDRRTANELLKQIRQHAKPNGDGSQRLAYCFADGLEARLAGTGSQLYHKLVAKRTT---ASDMLKAYHLYLAACPFKRLS 446
                      6789************************************************************999999...9******************** PP

             GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrl 186
                      h++ Nq+Il  ++++++vHiiDf+i  G+QWp+L++ L +R++gpp+lRiTg++ p++g   +e++eetg+rLa++Ae++gvpfe++  +a+++
  ORUFI03G31480.1 447 HFLSNQTILSLTKNASKVHIIDFGIYFGFQWPCLIRRLFKREGGPPKLRITGIDVPQPGfrPTERIEETGQRLAEYAEKIGVPFEYQG-IASKW 539
                      **********************************************************9*****************************.7**** PP

             GRAS 187 edleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklprese 280
                      e++ +e+L++k++E+++Vn+ ++  +l de+v+++s+r++vL+++++++P ++++   + +++ + F +rf eal ++salfd+le+++pr++ 
  ORUFI03G31480.1 540 ETICVEDLNIKKDEVVIVNCLYRFRNLIDETVAIDSPRNRVLNTIRQVNPAIFIHGIVNGSYSVPFFITRFREALFHFSALFDMLETTVPRDDA 633
                      ********************************************************************************************** PP

             GRAS 281 erikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlg 361
                      +r+ +Er l+gre+ nv+aceg++r+er et+++W+ r  +aGF + pl+++++ +ak  ++ ++ + + ++e+sg+l++g
  ORUFI03G31480.1 634 QRALIERDLFGREALNVIACEGSDRVERPETYKQWQVRNLRAGFVQSPLNQDIVLKAKDKVKDIYHKDFVIDEDSGWLLQG 714
                      *****************************************************************888*********9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098568.704330707IPR005202Transcription factor GRAS
PfamPF035142.2E-109356714IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 737 aa     Download sequence    Send to blast
MGLDNNFGEL SGMFCGLSYD GYTDHGSQSD YFRFADPQPA IVPQMDAGPS SAASSTASRA  60
AVSSGTDNPE DWEFISDESL NYISRMLMEE DIDEKVSMYQ EESAALRAAA KPFYDILGHK  120
FPPSPDRQLV AWPLDSPSES STSSYPHSLA SSVTSSNISG AVDSSQRRYV GHSEYRSLSG  180
HSSQPPVGPS SDVRNAMETL EDPLISNGRI PEYLFESFPT WDFRRGVDEA QKFLPGSDKV  240
VIDLEAGGVA KRQEAGKAIS LNVSKAEVLK VKKNRQSEDL DVMEGRNSKQ SAFCSDEPDW  300
IEMFDVLLRQ TEKKATDLRK MMRFEASKNS QVAQPKGPSG TRSRGRKPTK KDVVDLRTLL  360
IHCAQAVAAD DRRTANELLK QIRQHAKPNG DGSQRLAYCF ADGLEARLAG TGSQLYHKLV  420
AKRTTASDML KAYHLYLAAC PFKRLSHFLS NQTILSLTKN ASKVHIIDFG IYFGFQWPCL  480
IRRLFKREGG PPKLRITGID VPQPGFRPTE RIEETGQRLA EYAEKIGVPF EYQGIASKWE  540
TICVEDLNIK KDEVVIVNCL YRFRNLIDET VAIDSPRNRV LNTIRQVNPA IFIHGIVNGS  600
YSVPFFITRF REALFHFSAL FDMLETTVPR DDAQRALIER DLFGREALNV IACEGSDRVE  660
RPETYKQWQV RNLRAGFVQS PLNQDIVLKA KDKVKDIYHK DFVIDEDSGW LLQGYVYCCC  720
FSPFHLPASV IFYRDPN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-493606848330GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0972770.0AC097277.6 Oryza sativa chromosome 3 BAC OSJNBa0022C08 genomic sequence, complete sequence.
GenBankAK1014020.0AK101402.1 Oryza sativa Japonica Group cDNA clone:J033037F15, full insert sequence.
GenBankAK1018480.0AK101848.1 Oryza sativa Japonica Group cDNA clone:J033069K04, full insert sequence.
GenBankAP0149590.0AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
GenBankCP0126110.0CP012611.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 3 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015630936.10.0PREDICTED: scarecrow-like protein 9
RefseqXP_015630937.10.0PREDICTED: scarecrow-like protein 9
RefseqXP_015630938.10.0PREDICTED: scarecrow-like protein 9
RefseqXP_015630939.10.0PREDICTED: scarecrow-like protein 9
RefseqXP_015630940.10.0PREDICTED: scarecrow-like protein 9
RefseqXP_015630941.10.0PREDICTED: scarecrow-like protein 9
RefseqXP_015630942.10.0PREDICTED: scarecrow-like protein 9
RefseqXP_015630943.10.0PREDICTED: scarecrow-like protein 9
RefseqXP_015630944.10.0PREDICTED: scarecrow-like protein 9
TrEMBLA0A0E0NZU10.0A0A0E0NZU1_ORYRU; Uncharacterized protein
STRINGBGIOSGA010017-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP150538118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.10.0GRAS family protein